| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HOXA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.Use in Western blot reported in scientific literature (PMID 27832801). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HOXA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HOXA9. This antibody reacts with human, rat. The HOXA9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat HOXA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVD |
|---|
| Other Names | ABD-B, homeo box A9, homeobox A9, Homeobox protein Hox-1G, homeobox protein Hox-A9, homeobox protein HOXA9, homeodomain protein HOXA9, HOX1, HOX1.7, HOX1GMGC1934 |
|---|
| Gene, Accession # | HOXA9, Gene ID: 3205 |
|---|
| Catalog # | NBP2-32356 |
|---|
| Price | |
|---|
| Order / More Info | HOXA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27832801, 28399410, 29435001 |
|---|
| 产品资料 |
|
|