| 产品详情 |
| Edit |   |
| Antigenic Specificity | HOXA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 23684540). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HOXA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HOXA3. This antibody reacts with human. The HOXA3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HOXA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP |
| Other Names | homeo box A3, homeobox A3, Homeobox protein Hox-1E, homeobox protein Hox-A3, HOX1, Hox-1.5-like protein, HOX1Ehomeo box 1E, MGC10155 |
| Gene, Accession # | HOXA3, Gene ID: 3200, Accession: O43365, SwissProt: O43365 |
| Catalog # | NBP1-83234 |
| Price | |
| Order / More Info | HOXA3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23684540 |
| 产品资料 |
|
|