| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCK2. This antibody reacts with human. The PCK2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELE |
|---|
| Other Names | EC 4.1.1.32, PE, PEPCK, PEPCK2PEP carboxykinase, PEPCK-M, phosphoenolpyruvate carboxykinase [GTP], mitochondrial, phosphoenolpyruvate carboxykinase 2 (mitochondrial), Phosphoenolpyruvate carboxylase, phosphopyruvate carboxylase |
|---|
| Gene, Accession # | PCK2, Gene ID: 5106, Accession: Q16822, SwissProt: Q16822 |
|---|
| Catalog # | NBP2-33685 |
|---|
| Price | |
|---|
| Order / More Info | PCK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|