| Edit |   |
| Antigenic Specificity | GPR142 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPR142 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR142. This antibody reacts with human. The GPR142 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GPR142 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ |
| Other Names | G protein-coupled receptor 142, PGR2G-protein coupled receptor PGR2, probable G-protein coupled receptor 142 |
| Gene, Accession # | GPR142, Gene ID: 350383 |
| Catalog # | NBP1-87286 |
| Price | |
| Order / More Info | GPR142 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |