| Edit |   |
| Antigenic Specificity | SCML1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SCML1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCML1. This antibody reacts with human. The SCML1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SCML1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLAL |
| Other Names | sex comb on midleg (Drosophila)-like 1, sex comb on midleg-like 1 (Drosophila), sex comb on midleg-like protein 1 |
| Gene, Accession # | SCML1, Gene ID: 6322 |
| Catalog # | NBP1-85909 |
| Price | |
| Order / More Info | SCML1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |