| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPI8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPI8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPI8. This antibody reacts with human. The GPI8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPI8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL |
|---|
| Other Names | EC 3.-, GPI transamidase, GPI transamidase subunit, GPI8 homolog, GPI8class K, GPI-anchor transamidase, hGPI8, MGC22559, phosphatidylinositol glycan anchor biosynthesis, class K, Phosphatidylinositol-glycan biosynthesis class K protein, PIG-K |
|---|
| Gene, Accession # | PIGK, Gene ID: 10026, Accession: Q92643, SwissProt: Q92643 |
|---|
| Catalog # | NBP2-33812 |
|---|
| Price | |
|---|
| Order / More Info | GPI8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|