| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GFR alpha-2/GDNF R alpha-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GFR alpha-2/GDNF R alpha-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFR alpha-2/GDNF R alpha-2. This antibody reacts with human. The GFR alpha-2/GDNF R alpha-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GFR alpha-2/GDNFR alpha-2/GFRA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR |
|---|
| Other Names | GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha-2, GDNF receptor beta, GDNFR-alpha-2, GDNFR-beta, GDNFRBRET ligand 2, GFR-alpha 2, GFR-alpha-2, glial cell line derived neurotrophic factor receptor, beta, Neurturin receptor alpha, NRTNR-alpha, NTNRA, NTNR-alpha, PI-linked cell-surface accessory protein, RETL2TGF-beta-related neurotrophic factor receptor 2, TGF-beta related neurotrophic factor receptor 2, TRN receptor, GPI-anchored, TRNR2NRTNR-ALPHA |
|---|
| Gene, Accession # | GFRA2, Gene ID: 2675 |
|---|
| Catalog # | NBP1-89778 |
|---|
| Price | |
|---|
| Order / More Info | GFR alpha-2/GDNF R alpha-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|