| 产品详情 |
| Edit |   |
| Antigenic Specificity | GFR alpha-1/GDNF R alpha-1 |
| Clone | 1G4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GFR alpha-1/GDNF R alpha-1 Antibody (1G4) from Novus Biologicals is a mouse monoclonal antibody to GFR alpha-1/GDNF R alpha-1. This antibody reacts with human. The GFR alpha-1/GDNF R alpha-1 Antibody (1G4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | GFRA1 (NP_005255, 32 a.a. - 119 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS |
| Other Names | DKFZp313E1012, DKFZp686J0156, GDNF family receptor alpha 1, GDNF family receptor alpha-1, GDNF receptor alpha-1, GDNFRAGFR-ALPHA-1, GDNFR-alpha-1, GDNFRMGC23045, GFR-alpha-1, Glial cell line-derived neurotrophic factor receptor alpha, GPI-linked anchor protein, PI-linked cell-surface accessory protein, RET ligand 1, RET1L, RETL1FLJ10561, TGF-beta related neurotrophic factor receptor 1, TGF-beta-related neurotrophic factor receptor 1, TRNR1FLJ31546 |
| Gene, Accession # | GFRA1, Gene ID: 2674, Accession: NP_005255, SwissProt: NP_005255 |
| Catalog # | H00002674-M01 |
| Price | |
| Order / More Info | GFR alpha-1/GDNF R alpha-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|