| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GFR alpha-1/GDNF R alpha-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GFR alpha-1/GDNF R alpha-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFR alpha-1/GDNF R alpha-1. This antibody reacts with human. The GFR alpha-1/GDNF R alpha-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GFR alpha-1/GDNFR alpha-1/GFRA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK |
|---|
| Other Names | DKFZp313E1012, DKFZp686J0156, GDNF family receptor alpha 1, GDNF family receptor alpha-1, GDNF receptor alpha-1, GDNFRAGFR-ALPHA-1, GDNFR-alpha-1, GDNFRMGC23045, GFR-alpha-1, Glial cell line-derived neurotrophic factor receptor alpha, GPI-linked anchor protein, PI-linked cell-surface accessory protein, RET ligand 1, RET1L, RETL1FLJ10561, TGF-beta related neurotrophic factor receptor 1, TGF-beta-related neurotrophic factor receptor 1, TRNR1FLJ31546 |
|---|
| Gene, Accession # | GFRA1, Gene ID: 2674 |
|---|
| Catalog # | NBP2-14045 |
|---|
| Price | |
|---|
| Order / More Info | GFR alpha-1/GDNF R alpha-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|