| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GFPT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GFPT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFPT2. This antibody reacts with human, mouse. The GFPT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH. |
|---|
| Other Names | D-fructose-6-phosphate amidotransferase 2, FLJ10380, GFAT 2, GFAT2EC 2.6.1.16, glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2, glutamine: fructose-6-phosphate aminotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, glutamine-fructose-6-phosphate transaminase 2, Hexosephosphate aminotransferase 2 |
|---|
| Gene, Accession # | GFPT2, Gene ID: 9945, Accession: O94808, SwissProt: O94808 |
|---|
| Catalog # | NBP1-56688 |
|---|
| Price | |
|---|
| Order / More Info | GFPT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23407165 |
|---|
| 产品资料 |
|
|