| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBBP6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBBP6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBBP6. This antibody reacts with human. The RBBP6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RBBP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE |
|---|
| Other Names | E3 ubiquitin-protein ligase RBBP6, EC 6.3.2.-, MY038, P2PR, P2P-R, p53-associated cellular protein of testis, PACTDKFZp761B2423, Proliferation potential-related protein, Protein P2P-R, RB-binding Q-protein 1, RBQ1, RBQ-1, retinoblastoma binding protein 6, Retinoblastoma-binding protein 6DKFZp686P0638, Retinoblastoma-binding Q protein 1, SNAMA |
|---|
| Gene, Accession # | RBBP6, Gene ID: 5930 |
|---|
| Catalog # | NBP2-58777 |
|---|
| Price | |
|---|
| Order / More Info | RBBP6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|