| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Macro H2A.2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Macro H2A.2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Macro H2A.2. This antibody reacts with human, mouse, rat. The Macro H2A.2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Macro H2A |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL |
|---|
| Other Names | core histone macro-H2A.2, core histone macroH2A2.2, H2A histone family, member Y2, Histone macroH2A2, macroH2A2, mH2A2 |
|---|
| Gene, Accession # | H2AFY2, Gene ID: 55506, Accession: Q9P0M6, SwissProt: Q9P0M6 |
|---|
| Catalog # | NBP1-92094 |
|---|
| Price | |
|---|
| Order / More Info | Macro H2A.2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|