| Edit |   |
|---|
| Antigenic Specificity | MACC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MACC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MACC1. This antibody reacts with human. The MACC1 Antibody has been validated for the following applications: Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF |
|---|
| Other Names | metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5 |
|---|
| Gene, Accession # | MACC1, Gene ID: 346389 |
|---|
| Catalog # | NBP1-89352-25ul |
|---|
| Price | |
|---|
| Order / More Info | MACC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25785098, 25884643 |
|---|