| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MACC1 |
|---|
| Clone | CL0856 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MACC1 Antibody (CL0856) from Novus Biologicals is a mouse monoclonal antibody to MACC1. This antibody reacts with human. The MACC1 Antibody (CL0856) has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MACC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF |
|---|
| Other Names | metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5 |
|---|
| Gene, Accession # | MACC1, Gene ID: 346389 |
|---|
| Catalog # | NBP2-52955 |
|---|
| Price | |
|---|
| Order / More Info | MACC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|