| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBFOX3/NeuN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBFOX3/NeuN Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBFOX3/NeuN. This antibody reacts with human. The RBFOX3/NeuN Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RBFOX3/NeuN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ |
|---|
| Other Names | FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuronal nuclei, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3 |
|---|
| Gene, Accession # | RBFOX3, Gene ID: 146713 |
|---|
| Catalog # | NBP1-89821 |
|---|
| Price | |
|---|
| Order / More Info | RBFOX3/NeuN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22632721, 24747576 |
|---|
| 产品资料 |
|
|