| Edit |   |
|---|
| Antigenic Specificity | DKFZp566F084 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DKFZp566F084 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DKFZp566F084. This antibody reacts with human. The DKFZp566F084 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RP11-529I10.4(deleted in a mouse model of primary ciliary dyskinesia) The peptide sequence was selected from the N terminal of RP11-529I10.4. Peptide sequence MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNL |
|---|
| Other Names | deleted in a mouse model of primary ciliary dyskinesia, deleted in primary ciliary dyskinesia homolog (mouse), DKFZP566F084, protein DPCD, RP11-529I10.4 |
|---|
| Gene, Accession # | DPCD, Gene ID: 25911, Accession: Q9BVM2, SwissProt: Q9BVM2 |
|---|
| Catalog # | NBP1-55200 |
|---|
| Price | |
|---|
| Order / More Info | DKFZp566F084 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|