| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DLGAP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DLGAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DLGAP4. This antibody reacts with human. The DLGAP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DLGAP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL |
|---|
| Other Names | DAP4FLJ20588, discs, large (Drosophila) homolog-associated protein 4, disks large associated protein 4, disks large-associated protein 4, DLP4, KIAA0964MGC131862, PSD-95/SAP90-binding protein 4, RP5-977B1.6, SAP90/PSD-95-associated protein 4, SAPAP-4, SAPAP4DAP-4 |
|---|
| Gene, Accession # | DLGAP4, Gene ID: 22839, Accession: Q9Y2H0, SwissProt: Q9Y2H0 |
|---|
| Catalog # | NBP2-33271 |
|---|
| Price | |
|---|
| Order / More Info | DLGAP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|