| 产品详情 |
| Edit |   |
| Antigenic Specificity | PUF60 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PUF60 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PUF60. This antibody reacts with human. The PUF60 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA. |
| Other Names | FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, siah-BP1, SIAHBP1pyrimidine tract binding splicing factor |
| Gene, Accession # | PUF60, Gene ID: 22827, Accession: Q9UHX1-2, SwissProt: Q9UHX1-2 |
| Catalog # | NBP1-57501-20ul |
| Price | |
| Order / More Info | PUF60 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|