| 产品详情 |
| Edit |   |
| Antigenic Specificity | KLRAQ1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLRAQ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLRAQ1. This antibody reacts with human. The KLRAQ1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KLRAQ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LTRKYMETIEKLQNDKAKLEVKSQTLEKEAKECRLRTEECQLQLKTLHEDLSGRLEESLSIINEKVPFNDTKYSQYNALNVPLHNRRHQLKMRDIA |
| Other Names | CCDC128, coiled-coil domain containing 128, Coiled-coil domain-containing protein 128, FLJ16566, KLRAQ motif containing 1, KLRAQ motif-containing protein 1, MGC111781 |
| Gene, Accession # | PPP1R21, Gene ID: 129285, Accession: Q6ZMI0, SwissProt: Q6ZMI0 |
| Catalog # | NBP2-38331 |
| Price | |
| Order / More Info | KLRAQ1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|