| Edit |   |
|---|
| Antigenic Specificity | Klotho |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Klotho Antibody from Novus Biologicals is a rabbit polyclonal antibody to Klotho. This antibody reacts with human. The Klotho Antibody has been validated for the following applications: Western Blot. Recognizes Klotho isoform 2 (62 kDa band observed) |
|---|
| Immunogen | Synthetic peptides corresponding to KL(klotho) The peptide sequence was selected from the n terminal of KL (BAA24941). Peptide sequence FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP. |
|---|
| Other Names | EC 3.2.1, EC 3.2.1.31, klotho |
|---|
| Gene, Accession # | KL, Gene ID: 9365, Accession: Q9UEF7, SwissProt: Q9UEF7 |
|---|
| Catalog # | NBP1-55097 |
|---|
| Price | |
|---|
| Order / More Info | Klotho Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17893151 |
|---|