| 产品详情 |
| Edit |   |
| Antigenic Specificity | KMT3B/NSD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KMT3B/NSD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KMT3B/NSD1. This antibody reacts with human. The KMT3B/NSD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT |
| Other Names | Androgen receptor coactivator 267 kDa protein, Androgen receptor-associated protein of 267 kDa, ARA267STO, DKFZp666C163, EC 2.1.1.43, FLJ10684, FLJ22263, FLJ44628, H3 lysine-36 and H4 lysine-20 specific, KMT3BSotos syndrome, Lysine N-methyltransferase 3B, NR-binding SET domain-containing protein, nuclear receptor binding SET domain protein 1 |
| Gene, Accession # | NSD1, Gene ID: 64324 |
| Catalog # | NBP2-68968 |
| Price | |
| Order / More Info | KMT3B/NSD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|