| Edit |   |
| Antigenic Specificity | BCKDK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCKDK Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCKDK. This antibody reacts with human. The BCKDK Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to BCKDK(branched chain ketoacid dehydrogenase kinase) The peptide sequence was selected from the N terminal of BCKDK. Peptide sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD. |
| Other Names | BCKDHKIN, branched chain alpha-ketoacid dehydrogenase kinase, branched chain ketoacid dehydrogenase kinase, EC 2.7.11, EC 2.7.11.4, mitochondrial |
| Gene, Accession # | BCKDK, Gene ID: 10295, Accession: O14874, SwissProt: O14874 |
| Catalog # | NBP1-57574-20ul |
| Price | |
| Order / More Info | BCKDK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |