| Edit |   |
|---|
| Antigenic Specificity | BCKDK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCKDK Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCKDK. This antibody reacts with human. The BCKDK Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BCKDK(branched chain ketoacid dehydrogenase kinase) The peptide sequence was selected from the N terminal of BCKDK. Peptide sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD. |
|---|
| Other Names | BCKDHKIN, branched chain alpha-ketoacid dehydrogenase kinase, branched chain ketoacid dehydrogenase kinase, EC 2.7.11, EC 2.7.11.4, mitochondrial |
|---|
| Gene, Accession # | BCKDK, Gene ID: 10295, Accession: O14874, SwissProt: O14874 |
|---|
| Catalog # | NBP1-57574-20ul |
|---|
| Price | |
|---|
| Order / More Info | BCKDK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|