| 产品详情 |
| Edit |   |
| Antigenic Specificity | BCKDHB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCKDHB Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCKDHB. This antibody reacts with human. The BCKDHB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BCKDHB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD |
| Other Names | 2-oxoisovalerate dehydrogenase beta subunit, 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, BCKDE1B, BCKDH E1-beta, branched chain alpha-ketoacid dehydrogenase E1-beta subunit, branched chain keto acid dehydrogenase E1, beta polypeptide, Branched-chain alpha-keto acid dehydrogenase E1 component beta chain, dJ279A18.1, E1B, E1b-beta subunit of the branched-chain complex, EC 1.2.4.4, FLJ17880 |
| Gene, Accession # | BCKDHB, Gene ID: 594 |
| Catalog # | NBP1-86326 |
| Price | |
| Order / More Info | BCKDHB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|