| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMPK gamma 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMPK gamma 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMPK gamma 1. This antibody reacts with human. The AMPK gamma 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AMPK gamma 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METVISSDSSPAVENEHPQETPESNNSVYT |
|---|
| Other Names | 5'-AMP-activated protein kinase subunit gamma-1, 5'-AMP-activated protein kinase, gamma-1 subunit, AMPK gamma1, AMPK gamma-1 chain, AMPK subunit gamma-1, AMPKg, MGC8666, protein kinase, AMP-activated, gamma 1 non-catalytic subunit |
|---|
| Gene, Accession # | PRKAG1, Gene ID: 5571 |
|---|
| Catalog # | NBP2-57986 |
|---|
| Price | |
|---|
| Order / More Info | AMPK gamma 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|