| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMPK alpha 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMPK alpha 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMPK alpha 2. This antibody reacts with human. The AMPK alpha 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AMPK alpha 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR |
|---|
| Other Names | 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit |
|---|
| Gene, Accession # | PRKAA2, Gene ID: 5563, Accession: P54646, SwissProt: P54646 |
|---|
| Catalog # | NBP2-38532 |
|---|
| Price | |
|---|
| Order / More Info | AMPK alpha 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|