| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AGXT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. WB reactivity reported in scientific literature (PMID: 26609667). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGXT Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGXT. This antibody reacts with human, mouse. The AGXT Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AGXT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS |
|---|
| Other Names | AGT1L-alanine: glyoxylate aminotransferase 1, AGThepatic peroxisomal alanine:glyoxylate aminotransferase, AGXT1, alanine-glyoxylate aminotransferase, Alanine--glyoxylate aminotransferase, EC 2.6.1.44, EC 2.6.1.51, PH1, serine:pyruvate aminotransferase, SPATserine-pyruvate aminotransferase, SPTserine--pyruvate aminotransferase, TLH6 |
|---|
| Gene, Accession # | AGXT, Gene ID: 189, Accession: P21549, SwissProt: P21549 |
|---|
| Catalog # | NBP1-89200 |
|---|
| Price | |
|---|
| Order / More Info | AGXT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26609667 |
|---|
| 产品资料 |
|
|