| 产品详情 |
| Edit |   |
| Antigenic Specificity | AGXT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AGXT Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGXT. This antibody reacts with human. The AGXT Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AGXT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL |
| Other Names | AGT1L-alanine: glyoxylate aminotransferase 1, AGThepatic peroxisomal alanine:glyoxylate aminotransferase, AGXT1, alanine-glyoxylate aminotransferase, Alanine--glyoxylate aminotransferase, EC 2.6.1.44, EC 2.6.1.51, PH1, serine:pyruvate aminotransferase, SPATserine-pyruvate aminotransferase, SPTserine--pyruvate aminotransferase, TLH6 |
| Gene, Accession # | AGXT, Gene ID: 189, Accession: P21549, SwissProt: P21549 |
| Catalog # | NBP2-34198 |
| Price | |
| Order / More Info | AGXT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|