| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMPD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMPD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMPD3. This antibody reacts with human. The AMPD3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AMPD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES |
|---|
| Other Names | adenosine monophosphate deaminase (isoform E), adenosine monophosphate deaminase 3, AMP aminohydrolase, AMP deaminase 3, AMP deaminase isoform E, EC 3.5.4.6, Erythrocyte AMP deaminase, erythrocyte type AMP deaminase, erythrocyte-specific AMP deaminase, myoadenylate deaminase |
|---|
| Gene, Accession # | AMPD3, Gene ID: 272 |
|---|
| Catalog # | NBP2-58694 |
|---|
| Price | |
|---|
| Order / More Info | AMPD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|