| Edit |   |
| Antigenic Specificity | Lysyl Oxidase Homolog 3/LOXL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Lysyl Oxidase Homolog 3/LOXL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lysyl Oxidase Homolog 3/LOXL3. This antibody reacts with human. The Lysyl Oxidase Homolog 3/LOXL3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human LOXL3The immunogen for this antibody is LOXL3. Peptide sequence AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD. |
| Other Names | EC 1.4.3, EC 1.4.3.-, EC 1.4.3.13, LOXL, lysyl oxidase homolog 3, lysyl oxidase-like 3, Lysyl oxidase-like protein 3 |
| Gene, Accession # | LOXL3, Gene ID: 84695, Accession: NP_115992, SwissProt: NP_115992 |
| Catalog # | NBP1-79803 |
| Price | |
| Order / More Info | Lysyl Oxidase Homolog 3/LOXL3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |