| Edit |   |
|---|
| Antigenic Specificity | HAPLN4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HAPLN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HAPLN4. This antibody reacts with human. The HAPLN4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human HAPLN4The immunogen for this antibody is HAPLN4. Peptide sequence NYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV. |
|---|
| Other Names | BRAL2KIAA1926Brain link protein 2, hyaluronan and proteoglycan link protein 4 |
|---|
| Gene, Accession # | HAPLN4, Gene ID: 404037, Accession: NP_075378, SwissProt: NP_075378 |
|---|
| Catalog # | NBP1-79323-20ul |
|---|
| Price | |
|---|
| Order / More Info | HAPLN4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|