| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HAP40 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HAP40 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HAP40. This antibody reacts with human. The HAP40 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HAP40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: LLQPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV |
|---|
| Other Names | coagulation factor VIII-associated (intronic transcript) 1, coagulation factor VIII-associated 1, cpG island protein, DXS522E, F8A, factor VIII associated protein, factor VIII intron 22 protein, HAP40, huntingtin-associated protein 40 |
|---|
| Gene, Accession # | F8A1, Gene ID: 8263 |
|---|
| Catalog # | NBP2-54731 |
|---|
| Price | |
|---|
| Order / More Info | HAP40 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|