| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUFIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUFIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUFIP2. This antibody reacts with human. The NUFIP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NUFIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG |
|---|
| Other Names | 182-FIP, Cell proliferation-inducing gene 1 protein, FIP-82, FLJ10976, FMRP-interacting protein 2, Fragile X Mental Retardation Protein, KIAA1321PIG1,82-FIP82-kD FMRP Interacting Protein, MGC117262, nuclear fragile X mental retardation protein interacting protein 2, nuclear fragile X mental retardation-interacting protein 2, proliferation-inducing gene 1,82 kDa FMRP-interacting protein |
|---|
| Gene, Accession # | NUFIP2, Gene ID: 57532 |
|---|
| Catalog # | NBP2-55795 |
|---|
| Price | |
|---|
| Order / More Info | NUFIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|