| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD39L4/ENTPD5 |
|---|
| Clone | 4A5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD39L4/ENTPD5 Antibody (4A5) from Novus Biologicals is a mouse monoclonal antibody to CD39L4/ENTPD5. This antibody reacts with human. The CD39L4/ENTPD5 Antibody (4A5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ENTPD5 (NP_001240 319 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ |
|---|
| Other Names | CD39 antigen-like 4, CD39L4NTPDase 5, CD39-like 4, EC 3.6.1, EC 3.6.1.42, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 5, ER-UDPase, GDPase ENTPD5, Guanosine-diphosphatase ENTPD5, MGC163357, MGC163359, NTPDase-5, Nucleoside diphosphatase, PCPH, Pcph proto-oncogene protein, proto-oncogene CPH, UDPase ENTPD5, Uridine-diphosphatase ENTPD5 |
|---|
| Gene, Accession # | ENTPD5, Gene ID: 957, Accession: NP_001240, SwissProt: NP_001240 |
|---|
| Catalog # | H00000957-M07 |
|---|
| Price | |
|---|
| Order / More Info | CD39L4/ENTPD5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|