| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD39L3/ENTPD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD39L3/ENTPD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD39L3/ENTPD3. This antibody reacts with human. The CD39L3/ENTPD3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD39L3/ENTPD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGAT |
|---|
| Other Names | CD39 antigen-like 3, CD39L3EC 3.6.1.5, CD39-like 3, EC 3.6.1, Ecto-apyrase 3, Ecto-ATP diphosphohydrolase 3, Ecto-ATPase 3, Ecto-ATPDase 3, ectonucleoside triphosphate diphosphohydrolase 3, FLJ93839, HB6NTPDase 3, NTPDase-3 |
|---|
| Gene, Accession # | ENTPD3, Gene ID: 956 |
|---|
| Catalog # | NBP2-57781 |
|---|
| Price | |
|---|
| Order / More Info | CD39L3/ENTPD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|