| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD39L2/ENTPD6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD39L2/ENTPD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD39L2/ENTPD6. This antibody reacts with human. The CD39L2/ENTPD6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD39L2/ENTPD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLK |
|---|
| Other Names | CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6 |
|---|
| Gene, Accession # | ENTPD6, Gene ID: 955 |
|---|
| Catalog # | NBP2-58760 |
|---|
| Price | |
|---|
| Order / More Info | CD39L2/ENTPD6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|