| 产品详情 |
| Edit |   |
| Antigenic Specificity | CDK5RAP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDK5RAP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDK5RAP3. This antibody reacts with human, mouse, rat. The CDK5RAP3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CDK5RAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV |
| Other Names | C53, CDK5 activator-binding protein C53, CDK5 regulatory subunit associated protein 3, FLJ13660, HSF-27, IC53CDK5 regulatory subunit-associated protein 3, ischemic heart CDK5 activator-binding protein C53, LXXLL/leucine-zipper-containing ARFbinding protein, LZAP, MST016, OK/SW-cl.114, Protein HSF-27 |
| Gene, Accession # | CDK5RAP3, Gene ID: 80279 |
| Catalog # | NBP1-86779 |
| Price | |
| Order / More Info | CDK5RAP3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|