| 产品详情 |
| Edit |   |
| Antigenic Specificity | CDK5RAP2 |
| Clone | CL3392 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDK5RAP2 Antibody (CL3392) from Novus Biologicals is a mouse monoclonal antibody to CDK5RAP2. This antibody reacts with human. The CDK5RAP2 Antibody (CL3392) has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CDK5RAP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV |
| Other Names | C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633microcephaly, primary autosomal recessive 3, MCPH3 |
| Gene, Accession # | CDK5RAP2, Gene ID: 55755 |
| Catalog # | NBP2-59027 |
| Price | |
| Order / More Info | CDK5RAP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|