| Edit |   |
|---|
| Antigenic Specificity | CDKN2A Interacting protein N-Terminal Like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDKN2A Interacting protein N-Terminal Like Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDKN2A Interacting protein N-Terminal Like. This antibody reacts with human. The CDKN2A Interacting protein N-Terminal Like Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CDKN2A Interacting protein N-Terminal Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSE LMK |
|---|
| Other Names | CDKN2A interacting protein N-terminal like, CDKN2A-interacting protein N-terminal-like protein, CDKN2AIP N-terminal-like protein, MGC13017 |
|---|
| Gene, Accession # | CDKN2AIPNL, Gene ID: 91368 |
|---|
| Catalog # | NBP2-14466 |
|---|
| Price | |
|---|
| Order / More Info | CDKN2A Interacting protein N-Terminal Like Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|