| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PARC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PARC Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARC. This antibody reacts with human. The PARC Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PARC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WKPNHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHT |
|---|
| Other Names | CUL-9, cullin 9, cullin-9, DKFZp686G1042, H7AP1DKFZp686P2024, p53-associated parkin-like cytoplasmic protein, PARCKIAA0708, parkin-like cytoplasmic p53 binding protein, RP3-330M21.2, UbcH7-associated protein 1 |
|---|
| Gene, Accession # | CUL9, Gene ID: 23113 |
|---|
| Catalog # | NBP2-58049 |
|---|
| Price | |
|---|
| Order / More Info | PARC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|