| Edit |   |
|---|
| Antigenic Specificity | Parathyroid hormone 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Parathyroid hormone 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Parathyroid hormone 2. This antibody reacts with human. The Parathyroid hormone 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PTH2(parathyroid hormone 2) The peptide sequence was selected from the middle region of PTH2. Peptide sequence WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP. |
|---|
| Other Names | parathyroid hormone 2TIP39tuberoinfundibular 39 residue protein, TIPF39, tuberoinfundibular 39 residues, tuberoinfundibular peptide of 39 residues |
|---|
| Gene, Accession # | PTH2, Gene ID: 113091, Accession: Q96A98, SwissProt: Q96A98 |
|---|
| Catalog # | NBP1-69679 |
|---|
| Price | |
|---|
| Order / More Info | Parathyroid hormone 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|