| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC5A11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC5A11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC5A11. This antibody reacts with human. The SLC5A11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC5A11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK |
| Other Names | KST1RKST1, Na(+)/myo-inositol cotransporter 2, na+/myo-inositol cotransporter 2, putative sodium-coupled cotransporter RKST1, SGLT6, SLGTX, SMIT2homolog of rabbit KST1, Sodium/glucose cotransporter KST1, sodium/myo-inositol cotransporter 2, Sodium-dependent glucose cotransporter, solute carrier family 5 (sodium/glucose cotransporter), member 11, Solute carrier family 5 member 11 |
| Gene, Accession # | SLC5A11, Gene ID: 115584 |
| Catalog # | NBP1-82862 |
| Price | |
| Order / More Info | SLC5A11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|