| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC4A4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC4A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC4A4. This antibody reacts with human. The SLC4A4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC4A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS |
| Other Names | electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5 |
| Gene, Accession # | SLC4A4, Gene ID: 8671, Accession: Q9Y6R1, SwissProt: Q9Y6R1 |
| Catalog # | NBP2-32020 |
| Price | |
| Order / More Info | SLC4A4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|