| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fast skeletal myosin light chain 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fast skeletal myosin light chain 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fast skeletal myosin light chain 2. This antibody reacts with human. The Fast skeletal myosin light chain 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF |
|---|
| Other Names | DKFZp779C0757, Fast skeletal myosin light chain 2, HUMMLC2B, MGC13450, MLC2B, MRLC2, MYL11, myosin light chain 2, myosin light chain, phosphorylatable, fast skeletal muscle, myosin regulatory light chain 2, skeletal muscle isoform, myosin, light chain 11, regulatory |
|---|
| Gene, Accession # | MYLPF, Gene ID: 29895 |
|---|
| Catalog # | NBP2-62625 |
|---|
| Price | |
|---|
| Order / More Info | Fast skeletal myosin light chain 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|