| 产品详情 |
| Edit |   |
| Antigenic Specificity | Fast skeletal myosin light chain 1 |
| Clone | 2D9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fast skeletal myosin light chain 1 Antibody (2D9) from Novus Biologicals is a mouse monoclonal antibody to Fast skeletal myosin light chain 1. This antibody reacts with human. The Fast skeletal myosin light chain 1 Antibody (2D9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. |
| Immunogen | MYL1 (NP_524146, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK |
| Other Names | A1 catalytic, A2 catalytic, MLC1/MLC3, MLC1F, MLC1F/MLC3F, MLC3F, myosin light chain 1/3, skeletal muscle isoform, Myosin light chain A1/A2, Myosin light chain alkali 1/2, myosin, light chain 1, alkali; skeletal, fast, myosin, light polypeptide 1, alkali; skeletal, fast |
| Gene, Accession # | MYL1, Gene ID: 4632, Accession: NP_524146, SwissProt: NP_524146 |
| Catalog # | H00004632-M01 |
| Price | |
| Order / More Info | Fast skeletal myosin light chain 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|