| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LC3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LC3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to LC3B. This antibody reacts with human. The LC3B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LC3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: MPSEKTFKQRRTFEQRVEDVRLIREQHPTK |
|---|
| Other Names | anti-LC3B, atg8f , Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, LC3B ihc, LC3B immunohistochemistry, LC3B immunoprecipitation, LC3B monoclonal, LC3B western blot, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated protein 1 light chain 3 betaMAP1A/MAP1B light chain 3 B, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B |
|---|
| Gene, Accession # | MAP1LC3B, Gene ID: 81631 |
|---|
| Catalog # | NBP2-54742 |
|---|
| Price | |
|---|
| Order / More Info | LC3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|