| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BTBD15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BTBD15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BTBD15. This antibody reacts with human. The BTBD15 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BTBD15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVISQYHS |
|---|
| Other Names | BTB (POZ) domain containing 15, BTB/POZ domain-containing protein 15, BTBD15, HSPC063, MGC57431, MGC60348, MGC88058, zinc finger and BTB domain containing 44, zinc finger and BTB domain-containing protein 44, Zinc finger protein 851, ZNF851MGC26123 |
|---|
| Gene, Accession # | ZBTB44, Gene ID: 29068 |
|---|
| Catalog # | NBP2-47539 |
|---|
| Price | |
|---|
| Order / More Info | BTBD15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|