| Edit |   |
|---|
| Antigenic Specificity | BTBD12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BTBD12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BTBD12. This antibody reacts with human. The BTBD12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human BTBD12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA |
|---|
| Other Names | BTB (POZ) domain containing 12, BTB/POZ domain-containing protein 12, BTBD12structure-specific endonuclease subunit SLX4, KIAA1784MUS312, KIAA1987FANCP, SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) |
|---|
| Gene, Accession # | SLX4, Gene ID: 84464 |
|---|
| Catalog # | NBP2-58436 |
|---|
| Price | |
|---|
| Order / More Info | BTBD12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|