| Edit |   |
|---|
| Antigenic Specificity | AREL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AREL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AREL1. This antibody reacts with human. The AREL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA0317(KIAA0317) The peptide sequence was selected from the middle region of KIAA0317. Peptide sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF. |
|---|
| Other Names | apoptosis resistant E3 ubiquitin protein ligase 1, FIEL1, hypothetical protein LOC9870, KIAA0317 |
|---|
| Gene, Accession # | KIAA0317, Gene ID: 9870, Accession: O15033, SwissProt: O15033 |
|---|
| Catalog # | NBP1-59393-20ul |
|---|
| Price | |
|---|
| Order / More Info | AREL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|