| Edit |   |
| Antigenic Specificity | Archaemetzincin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Archaemetzincin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Archaemetzincin 2. This antibody reacts with human. The Archaemetzincin 2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human AMZ2. Peptide sequence ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE. |
| Other Names | archaelysin family metallopeptidase 2, archaemetzincin-2, archaemetzincins-2, Archeobacterial metalloproteinase-like protein 2, EC 3.- |
| Gene, Accession # | AMZ2, Gene ID: 51321, Accession: NP_001028746, SwissProt: NP_001028746 |
| Catalog # | NBP1-79621 |
| Price | |
| Order / More Info | Archaemetzincin 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |