| Edit |   |
| Antigenic Specificity | Ribosomal protein S27 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ribosomal protein S27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ribosomal protein S27. This antibody reacts with human. The Ribosomal protein S27 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Ribosomal protein S27 - N-terminal region. Peptide sequence DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL. |
| Other Names | Metallopan-stimulin 1, MPS140S ribosomal protein S27, MPS-1metallopanstimulin 1, ribosomal protein S27, ribosomal protein S27 (metallopanstimulin 1) |
| Gene, Accession # | RPS27, Gene ID: 6232, Accession: NP_001021, SwissProt: NP_001021 |
| Catalog # | NBP1-98598 |
| Price | |
| Order / More Info | Ribosomal protein S27 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |